Raw sequence format

From BioPerl
Jump to: navigation, search


Description

This file format can be parsed by the Bio::SeqIO system using the Bio::SeqIO::raw module. Is this format one sequence per line? Or are all non-whitespace characters in the whole file one sequence?

Example

MVNSNQNQNGNSNGHDDDFPQDSITEPEHMRKLFIGGLDYRTTDENLKAHEKWG
Personal tools
Namespaces
Variants
Actions
Main Links
documentation
community
development
Toolbox