PIR sequence format

From BioPerl
Jump to: navigation, search


Description

Here is a description of the PIR format. The PIR format is also sometimes called the NBRF format.

This file format can be parsed by the Bio::SeqIO system using the Bio::SeqIO::pir module.

Example

>P1;roa1_drome
Rea guano receptor type III >> 0.1
MVNSNQNQNGNSNGHDDDFPQDSITEPEHMRKLFIGGLDYRTTDENLKAHEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRPHKIDGRVEPKRA
VPRQDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDNIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPKNDQQGGGGGRG
GPGGRAGGNRGNMGGGNYGNQNGGGNWNNGGNNWGNNRGNDNWGNNSFGGGGGGGGGYGGGNNSWGNNNPWDNGNGGGNFGGGGNNWNGGNDFGGYQQNYGGGP
QRGGGNFNNNRMQPYQGGGGFKAGGGNQGNYGNNQGFNNGGNNRRY*

>P1;roa2_drome
Rea guano ligand
MVNSNQNQNGNSNGHDDDFPQDSITEPEHMRKLFIGGLDYRTTDENLKAHEKWGNIVDVVVMKDPTSTSTSTSTSTSTSTSTMIDEAQKSRPHKIDGRVEPKRA
VPRQDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQHLLLLLLLDLLLLDLLLLDLLLFVEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPKNDQQGGGGGRG
GPGGRAGGNRGNMGGGNYGNQNGGGNWNNGGNNWGNNRGNDNWGNNSFGGGGGGGGGYGGGNNSWGNNNPWDNGNGGGNFGGGGNNWNGGNDFGGYQQNYGGGP
QRGGGNFNNNRMQPYQGGGGFKAGGGNQGNYGNNQGFNNGGNNRRY*
Personal tools
Namespaces
Variants
Actions
Main Links
documentation
community
development
Toolbox