BioPerl Locations

From BioPerl

Jump to: navigation, search

This is a spec page, sort of an open discussion about how locations are defined in BioPerl, mainly generated from a recent thread on the mailing list. Who knows, this may be incorporated into a HOWTO or evolve into one on its own.

Any comments or changes presented here will not be incorporated into the stable (1.6) release but will possibly appear in the next developer release cycle (1.7).

Some examples are 'borrowed' from the BioRuby Locations docs.

Opinions, comments, and boos/hisses appreciated (?!?).

Contents

Locations in BioPerl

It is difficult to discuss what we mean by 'locations' without also briefly mentioning sequence features. Currently, BioPerl splits any generic features in a sequence record into two general groups:

  • Information pertaining to the sequence as a whole are Annotation (thus implementing Bio::AnnotationI)
  • information that describes a particular region or regions, or 'locations', of a sequence (thus implementing Bio::SeqFeatureI).

A group of classes (Bio::Location) was devised in order to describe locations in a generic way.

How location data is handled in BioPerl

Any Bio::LocationI, at it's core, is also a Bio::RangeI. In the generic sense, this means that the class must define the following methods:

TODO: Make table

  • start
  • end
  • strand

Factory

Bio::Factory::FTLocationFactory

Where does gap fit in here (found in CONTIG files), or do we plan on supporting it?

Coordinates

Definition of start/end coordinates, coordinate policies, etc.

Types of Locations

The following all implement Bio::LocationI.

Simple

Bio::Location::Atomic

Bio::Location::Simple

Fuzzy

Bio::Location::Fuzzy

Deprecated fuzzy location types

Split

At this time, all split locations are handled by one class (Bio::Location::Split), which implements methods from Bio::Location::SplitLocationI and Bio::LocationI.

join(location,location, ... location)

The indicated elements should be joined (placed end-to-end) to form one contiguous sequence. Far and away the most common split location type. Use of this operator implies that the locations are meant to be joined together in the order listed.

There are some ambiguities in the way this location type is handled in BioPerl, particularly re: circular sequences where the location is split across the origin.

Examples:Simple subLocations

NCBI and EBI currently use differing but syntactically similar versions of a split location string on the complement strand.

From GenBank : AL137247

                    ...
    mRNA            complement(join(3207..4831,5834..5902,8881..8969,
                    9276..9403,29535..29764))
                    /locus_tag="RP11-298P3.2-001"
                    /note="match: ESTs: AA890530 AI675036 AI701009 AI916535
                    AW592106 BE479269 BE645120 BE672552 BM145066 BM996077
                    R61510
                    match: cDNAs: AL049787 BC022188 BQ003364 U50527"
                    ...

From EMBL : AL137247

                     ...
FT   mRNA            join(complement(29535..29764),complement(9276..9403),
FT                   complement(8881..8969),complement(5834..5902),
FT                   complement(3207..4831))
FT                   /locus_tag="RP11-298P3.2-001"
FT                   /note="match: ESTs: AA890530 AI675036 AI701009 AI916535
FT                   AW592106 BE479269 BE645120 BE672552 BM145066 BM996077
FT                   R61510"
FT                   /note="match: cDNAs: AL049787 BC022188 BQ003364 U50527"
                     ...

Examples:Remote subLocations

From AF130134 :

                    ...
    mRNA            join(AF130124.1:<2563..2964,AF130125.1:21..157,
                    AF130126.1:12..174,AF130127.1:21..112,AF130128.1:21..162,
                    AF130128.1:281..595,AF130128.1:661..842,
                    AF130128.1:916..1030,AF130129.1:21..115,
                    AF130130.1:21..165,AF130131.1:21..125,AF130132.1:21..428,
                    AF130132.1:492..746,AF130133.1:21..168,
                    AF130133.1:232..401,AF130133.1:475..906,
                    AF130133.1:970..1107,AF130133.1:1176..1367,21..>128)
                    ...

NCBI uses EMBL-like location strings (see above) when some of the sublocations are remote and complementary.

From AL137247 :

                    ...
    mRNA            join(complement(AL353665.13:2815..2862),
                    complement(AL353665.13:453..500),
                    complement(AL353665.13:112..273),complement(47990..48111),
                    complement(44019..45757),complement(40283..40368),
                    complement(37992..38036),complement(34048..34603))
                    /locus_tag="RP11-298P3.4-001"
                    /note="match: ESTs: AA593603 AA737293 AA778631 AI718289
                    AU137161 AV726785 AW243426 BM055268 BM887924
                    match: cDNAs: AL049802 AL049802.1 U50529 U50529.1"
                    ...

Example: Split location in circular sequence [1] (S. solfataricus genome)

    CDS             join(2991448..2992245,1..252)
                    /locus_tag="SSO12256"
                    /note="Similar to cellulose synthase homologs ydaM and
                    icaA, probably involved in cell wall biogenesis or
                    intercellular adhesion; Cell Envelope, Surface
                    polysaccharides and lipopolysaccharides"
                    /codon_start=1
                    /transl_table=11
                    /product="Glycosyltransferase, putative"
                    /protein_id="NP_341577.1"
                    /db_xref="GI:15896972"
                    /db_xref="GeneID:1455270"
                    /translation="MIVPVKNEERVLPRLLDRLVNLEYDKSKYEIIVVEDGSTDRTFQ
                    ICKEYEIKYNNLIRCYSLPRANVPNGKSRALNFALRISKGEIIGIFDGDTVPRLDILE
                    YVEPKFEDITVGAVQGKLVPINVRESVTSRLAAIEELIYEYSIAGRAKVGLFVPIEGT
                    CSFIRKSIIMELGGWNEYSLTEDLDISLKIVNKGCKIVYSPTTISWREVPVSLRVLIR
                    QRLRWYRGHLEVQLGKLRKIDLRIIDGILIVLTPFFMVLNLVNYSLVLVYSSSLYIVA
                    ASLVSLASLLSLLLIILIARRHMIEYFYMIPSFVYMNFIVALNFTAIFLELIRAPRVW
                    VKTERSAKVTGEVMG"

order(location,location, ... location)

The elements can be found in the specified order (5' to 3' direction), but nothing is implied about the reasonableness about joining them.

Not as commonly used, but necessary to describe the locations of features like repeated sequences, etc. Note that one might think you could assign a strand for the split location object, you are allowed to have different strands for the sublocations using this operator.

Examples:Simple subLocations

From AF006691:

                    ...
    repeat_region   order(912..1918,20410..21416)
                    /rpt_type=direct
                    ...

From AF264948:

                    ...
    repeat_region   order(11375..11410,15692..15727)
                    /note="similar to inverted repeats found in IS911"
                    /rpt_type=direct
                    ...

From NC_003384:

    ...
    repeat_region   complement(order(153546..153558,154281..154293))
                    /rpt_type=inverted
    repeat_region   complement(order(159639..159653,160446..160460))
                    /rpt_type=inverted
    repeat_region   complement(order(160655..160668,161461..161474))
                    /rpt_type=inverted
    ...

Examples:Simple subLocations with mixed strands

From AF264948:

    ...
    primer_bind     order(3..26,complement(964..987))
    ...

Examples:Remote subLocations

From AF081826:

    ...
    gene            order(complement(1009..>1260),complement(AF081827.1:<1..177))
                    /gene="csgD"
    ...

bond(location,location...location)

Found in protein files. These generally are used to describe disulfide bonds. Some of these location types imply that the order of the location is important (see the example below for 1XDA_D).

Note that this split location type is not described in the GenBank/EMBL/DDBJ Feature Table definition, presumably because it pertains to protein sequences, not nucleotide sequences.

Examples:Simple subLocations

From 1TGS_Z:

    ...
    Bond            bond(115,216)
                    /bond_type="disulfide"
    SecStr          120..126
                    /sec_str_type="sheet"
                    /note="strand 11"
    Bond            bond(122,189)
                    /bond_type="disulfide"
    ...

Examples:Complex subLocations

From 1TGS_Z:

    ...
    Het             join(bond(58),bond(60),bond(60),bond(63),bond(68),
                    bond(68),bond(68))
                    /heterogen="( CA, 800 ) Calcium Ion"
    ...

From 1XDA_D:

    ...
    Het             join(bond(29),bond(29),bond(3),bond(3))
                    /heterogen="(MYR,  39 )"
    Region          4..>29
                    /region_name="IlGF"
                    /note="Insulin / insulin-like growth factor / relaxin
                    family; smart00078"
                    /db_xref="CDD:47425"
    Het             join(bond(29),bond(29))
                    /heterogen="(MYR,  39 )"
    ...

Examples:Remote subLocations

There are no apparent remote sublocations used for bonds. If a link to another sequence is implied, it apparently is indicated in the feature tags, not in the location string.

From P67973_1, whale insulin:

    ...
    Bond            bond(7,7)
                    /gene="INS"
                    /bond_type="disulfide"
                    /experiment="experimental evidence, no additional details
                    recorded"
                    /note="Interchain (between B and A chains)."
    Bond            bond(19,20)
                    /gene="INS"
                    /bond_type="disulfide"
                    /experiment="experimental evidence, no additional details
                    recorded"
                    /note="Interchain (between B and A chains)."
    ...

Deprecated split locations

The following split location operators were in GenBank releases prior to rel. 122 and older EMBL releases, but have long since been removed. They are not supported in BioPerl.

group

group(location, location, .. location): The elements are related and
should be grouped together, but no order is implied.

This differs from order in that there is no 5'->3' order of the sublocations.

one-of

one-of(location, location, .. location): The element can be any one,
but only one, of the items listed.

These elements were used at one point for describing split locations where the exact position of one sublocation was uncertain but could be picked from a group. These were mainly encountered with genes that were alternatively spliced but were also used for describing variation data. Now the individually spliced genes are described in separate sequence features, using regular join or order operators.

Of note, there are still a few of these sequences in GenBank: accession ATU39449 is an example (at least for the time being). One might also encounter these in the annotation COMMENTS section:

BD076522.1

E01483.1

Personal tools